Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF1 Peptide - middle region

EIF1 Peptide - middle region

Product Specifications

Product Name Alternative

A121, EIF-1, EIF1A, ISO1, SUI1

UniProt

P41567

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF1 Rabbit Polyclonal Antibody (orb585808) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005792

Preservative

Lyophilized powder

AA Sequence

DKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MYL3 Protein Lysate
MBS8415689-01 0.02 mg

Human MYL3 Protein Lysate

Sign In for Pricing
View Details
Human MYL3 Protein Lysate
MBS8415689-02 5x 0.02 mg

Human MYL3 Protein Lysate

Sign In for Pricing
View Details
Anti-MERTK Antibody Picoband®
A00489-2 100 µg/Vial

Anti-MERTK Antibody Picoband®

Sign In for Pricing
View Details
Recombinant Human EPO
Z101435 50 µg

Recombinant Human EPO

Sign In for Pricing
View Details
CRTAC1 Protein Vector (Mouse) (pPB-C-His)
PV168138 500 ng

CRTAC1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Ethyl (3-amino-3-cyanopropyl) methylphosphinate
275649-01 500 mg

Ethyl (3-amino-3-cyanopropyl) methylphosphinate

Sign In for Pricing
View Details