Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF17 Peptide - C-terminal region

TNFRSF17 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BCM, BCMA, CD269

UniProt

Q02223

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNFRSF17 Rabbit Polyclonal Antibody (orb585811) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001183

Preservative

Lyophilized powder

AA Sequence

EYTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cadherin-3, C-His Tag
HA211162-01 20 µg

Human Cadherin-3, C-His Tag

Sign In for Pricing
View Details
Human Cadherin-3, C-His Tag
HA211162-02 50 µg

Human Cadherin-3, C-His Tag

Sign In for Pricing
View Details
Human Cadherin-3, C-His Tag
HA211162-03 100 µg

Human Cadherin-3, C-His Tag

Sign In for Pricing
View Details
PDLIM5 Human Gene Knockout Kit (CRISPR)
KN400592 1 Kit

PDLIM5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL34 Human
OM296409-01 10 µg

IL34 Human

Sign In for Pricing
View Details
IL34 Human
OM296409-02 2 µg

IL34 Human

Sign In for Pricing
View Details