Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF17 Peptide - C-terminal region

TNFRSF17 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BCM, BCMA, CD269

UniProt

Q02223

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNFRSF17 Rabbit Polyclonal Antibody (orb585811) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001183

Preservative

Lyophilized powder

AA Sequence

EYTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC12A Rabbit Polyclonal Antibody
TA372356 100 µL

CLEC12A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOX Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6B7]
TA500869BM 100 µL

LOX Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6B7]

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR562652 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
Recombinant Human Galectin-4 protein (His Tag)
PKSH034184-01 20 µg

Recombinant Human Galectin-4 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Galectin-4 protein (His Tag)
PKSH034184-02 100 µg

Recombinant Human Galectin-4 protein (His Tag)

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1994R), CF640R conjugate, 0.1mg/mL
BNC401994-100 1x 100 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1994R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details