Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIPR Peptide - N-terminal region

GIPR Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC126722, PGQTL2

UniProt

P48546

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GIPR Rabbit Polyclonal Antibody (orb331253) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000155

Preservative

Lyophilized powder

AA Sequence

GFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQVMYTVGYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Optional single channel adapter, extra long (80mm) stainless steel
V1002-1SL 1 Each

Optional single channel adapter, extra long (80mm) stainless steel

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (HSV1/1934), 0.2mg/mL
BNUB1934-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) (HSV1/1934), 0.2mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Lung: left lower lobe
CR562571 5 µg

Tissue Total RNA, Lung: left lower lobe

Sign In for Pricing
View Details
XFD405 azide
70013-AAT 1 mg

XFD405 azide

Sign In for Pricing
View Details
Human SIRT1 (Sirtuin 1) ELISA Kit
E-EL-H1546-01 24 Tests

Human SIRT1 (Sirtuin 1) ELISA Kit

Sign In for Pricing
View Details
Human SIRT1 (Sirtuin 1) ELISA Kit
E-EL-H1546-02 48 Tests

Human SIRT1 (Sirtuin 1) ELISA Kit

Sign In for Pricing
View Details