Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIPR Peptide - N-terminal region

GIPR Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC126722, PGQTL2

UniProt

P48546

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GIPR Rabbit Polyclonal Antibody (orb331253) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000155

Preservative

Lyophilized powder

AA Sequence

GFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQVMYTVGYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
BNC402853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RPL22L1 (NM_001099645) Human Over-expression Lysate
LY420471 100 µg

RPL22L1 (NM_001099645) Human Over-expression Lysate

Sign In for Pricing
View Details
Human C1orf122 activation kit by CRISPRa
GA115009 1 Kit

Human C1orf122 activation kit by CRISPRa

Sign In for Pricing
View Details
Metanil Yellow
TRC-M321778-5G 5 g

Metanil Yellow

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-500 1x 500 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
rac 1-Palmitoyl-3-chloropropanediol-d5
TRC-P156502-1MG 1 mg

rac 1-Palmitoyl-3-chloropropanediol-d5

Sign In for Pricing
View Details