Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STRA8 Peptide - C-terminal region

STRA8 Peptide - C-terminal region

Product Specifications

UniProt

Q7Z7C7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STRA8 Rabbit Polyclonal Antibody (orb585824) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872295

Preservative

Lyophilized powder

AA Sequence

PEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Corey PG-Lactone Diol
sc-223900 1 g

Corey PG-Lactone Diol

Sign In for Pricing
View Details
CD147 (BSG) (NM_198591) Human Recombinant Protein
E45H34929M5 20 µg

CD147 (BSG) (NM_198591) Human Recombinant Protein

Sign In for Pricing
View Details
EFCAB4A Protein Vector (Human) (pPM-C-HA)
18996021 500 ng

EFCAB4A Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rab13
E8EM1707-79 100 µL

Rab13

Sign In for Pricing
View Details
Dehydro Aripiprazole Hydrochloride
CS-O-07238 1 Each

Dehydro Aripiprazole Hydrochloride

Sign In for Pricing
View Details
Methyl 1-Thiolincosaminide
017450 50 mg

Methyl 1-Thiolincosaminide

Sign In for Pricing
View Details