Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYDGF Peptide - middle region

MYDGF Peptide - middle region

Product Specifications

Product Name Alternative

IL25, IL27, SF20, IL27w, C19orf10, R33729_1, EUROIMAGE1875335

UniProt

Q969H8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYDGF Rabbit Polyclonal Antibody (orb585825) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_061980

Preservative

Lyophilized powder

AA Sequence

YASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP36 Rabbit Polyclonal Antibody
TA344664 100 µL

USP36 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM171A1 Rabbit Polyclonal Antibody (BF750)
orb2511512 100 µL

FAM171A1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Whsc1 3'UTR GFP Stable Cell Line
TU273402 1.0 mL

Whsc1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-ENSA Antibody, Rabbit Polyclonal
MBS8107310-01 0.1 mL

Anti-ENSA Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-ENSA Antibody, Rabbit Polyclonal
MBS8107310-02 5x 0.1 mL

Anti-ENSA Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Rabbit Anti-Human SCD5 pAb
PA6749-01 50 μL

Rabbit Anti-Human SCD5 pAb

Sign In for Pricing
View Details