Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYDGF Peptide - middle region

MYDGF Peptide - middle region

Product Specifications

Product Name Alternative

IL25, IL27, SF20, IL27w, C19orf10, R33729_1, EUROIMAGE1875335

UniProt

Q969H8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYDGF Rabbit Polyclonal Antibody (orb585825) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_061980

Preservative

Lyophilized powder

AA Sequence

YASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-rno-mir-455 Virus
mr0311 250 µL

AdmiRa-rno-mir-455 Virus

Sign In for Pricing
View Details
HPCA Protein Lysate (Mouse) with C-HA Tag
23853035 100 µg

HPCA Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
PTEN Human Gene Knockout Kit (CRISPR)
KN202627LP 1 Kit

PTEN Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BAFF (TNFSF13B) Rabbit Polyclonal Antibody
TA344292 100 µL

BAFF (TNFSF13B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DDX50 Protein Vector (Mouse) (pPB-N-His)
PV171259 500 ng

DDX50 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
ST6GAL1 Antibody
ABD3950 100 µg

ST6GAL1 Antibody

Sign In for Pricing
View Details