Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIMS1 Peptide - C-terminal region

LIMS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PINCH, PINCH1

UniProt

B7Z7R3

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIMS1 Rabbit Polyclonal Antibody (orb585832) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001180414

Preservative

Lyophilized powder

AA Sequence

VNCFACSTCNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin Beta A (INHbA) Magnetic Luminex Assay Kit
LKU605278 96 Tests

Inhibin Beta A (INHbA) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Fruit fly Mal-B1/B1 Rabbit Polyclonal Antibody
orb1152270 200 µL

Fruit fly Mal-B1/B1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Monoclonal L-Selectin/CD62L Antibody (95226) [DyLight 550]
FAB5762L 0.5 mL

Rat Monoclonal L-Selectin/CD62L Antibody (95226) [DyLight 550]

Sign In for Pricing
View Details
Conjugated TCP1 beta Rabbit mAb
C56563 100 µL

Conjugated TCP1 beta Rabbit mAb

Sign In for Pricing
View Details
Rheb (E1G1R) Rabbit Monoclonal Antibody
CST 13879S 100 µL

Rheb (E1G1R) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Lysozyme Polyclonal Antibody, PE-Cy5 Conjugated
bs-0816R-PE-Cy5-01 20 µL

Lysozyme Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details