Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIMS1 Peptide - C-terminal region

LIMS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PINCH, PINCH1

UniProt

B7Z7R3

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIMS1 Rabbit Polyclonal Antibody (orb585832) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001180414

Preservative

Lyophilized powder

AA Sequence

VNCFACSTCNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triap1 Rat shRNA Lentiviral Particle (Locus ID 691278)
TL708309V 500 µL Each

Triap1 Rat shRNA Lentiviral Particle (Locus ID 691278)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung: left upper lobe
CS716699 5x 5 µm

Tissue FFPE Sections, Lung: left upper lobe

Sign In for Pricing
View Details
Phosphorus oxybromide 99%
P17210-01 5 g

Phosphorus oxybromide 99%

Sign In for Pricing
View Details
Phosphorus oxybromide 99%
P17210-02 25 g

Phosphorus oxybromide 99%

Sign In for Pricing
View Details
Phosphorus oxybromide 99%
P17210-03 100 g

Phosphorus oxybromide 99%

Sign In for Pricing
View Details
anti-PRMT5
YF-PA16948 50 ul

anti-PRMT5

Sign In for Pricing
View Details