Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1 Peptide - C-terminal region

ST6GAL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC48859, SIAT1, ST6GalI, ST6N

UniProt

B2R513

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ST6GAL1 Rabbit Polyclonal Antibody (orb585856) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775324

Preservative

Lyophilized powder

AA Sequence

PPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGLT2 (SLC5A2) (NM_003041) Human Over-expression Lysate
LY418937 100 µg

SGLT2 (SLC5A2) (NM_003041) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS625384 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF488A conjugate, 0.1mg/mL
BNC882556-500 1x 500 µL

Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdcp2 Mouse Gene Knockout Kit (CRISPR)
KN502997 1 Kit

Cdcp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5,6-Dihydro-6-ethenyl-4-hydroxy-2H-pyran-2-one
TRC-D450725-250MG 250 mg

5,6-Dihydro-6-ethenyl-4-hydroxy-2H-pyran-2-one

Sign In for Pricing
View Details
a-Hydroxy-4-(4-hydroxy-3,5-dinitrophenoxy)-3,5-diiodo-benzenepropanoic Acid
TRC-H942963-500MG 500 mg

a-Hydroxy-4-(4-hydroxy-3,5-dinitrophenoxy)-3,5-diiodo-benzenepropanoic Acid

Sign In for Pricing
View Details