Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1 Peptide - C-terminal region

ST6GAL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC48859, SIAT1, ST6GalI, ST6N

UniProt

B2R513

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ST6GAL1 Rabbit Polyclonal Antibody (orb585856) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775324

Preservative

Lyophilized powder

AA Sequence

PPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stfa3 Mouse Gene Knockout Kit (CRISPR)
KN516862 1 Kit

Stfa3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GADD45G Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E2]
TA505500AM 100 µL

GADD45G Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E2]

Sign In for Pricing
View Details
Caspase 4 (CASP4) (NM_001225) Human Over-expression Lysate
LC400489 20 µg

Caspase 4 (CASP4) (NM_001225) Human Over-expression Lysate

Sign In for Pricing
View Details
SAMD7 (Center) Rabbit Polyclonal Antibody
AP53792PU-N 400 µL

SAMD7 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
S100 alpha 6 (S100A6) Rabbit Monoclonal Antibody
TA422907 100 µL

S100 alpha 6 (S100A6) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Arrb1 Mouse Gene Knockout Kit (CRISPR)
KN501616 1 Kit

Arrb1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details