Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMDS Peptide - C-terminal region

GMDS Peptide - C-terminal region

Product Specifications

Product Name Alternative

GMD, SDR3E1

UniProt

E9PI88

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GMDS Rabbit Polyclonal Antibody (orb585867) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001240775

Preservative

Lyophilized powder

AA Sequence

WEGKNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pinacolone
TRC-P457800-25G 25 g

Pinacolone

Sign In for Pricing
View Details
SPANXN3 (NM_001009609) Human Over-expression Lysate
LC422924 20 µg

SPANXN3 (NM_001009609) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SLFN14 activation kit by CRISPRa
GA117541 1 Kit

Human SLFN14 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Rat HP Protein (His Tag)
PDMR100058-01 20 µg

Recombinant Rat HP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat HP Protein (His Tag)
PDMR100058-02 100 µg

Recombinant Rat HP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat HP Protein (His Tag)
PDMR100058-03 500 µg

Recombinant Rat HP Protein (His Tag)

Sign In for Pricing
View Details