Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMDS Peptide - C-terminal region

GMDS Peptide - C-terminal region

Product Specifications

Product Name Alternative

GMD, SDR3E1

UniProt

E9PI88

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GMDS Rabbit Polyclonal Antibody (orb585867) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001240775

Preservative

Lyophilized powder

AA Sequence

WEGKNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Claudin-1 Antibody
RC-16870-01 50 μL

Recombinant Claudin-1 Antibody

Sign In for Pricing
View Details
Recombinant Claudin-1 Antibody
RC-16870-02 100 µL

Recombinant Claudin-1 Antibody

Sign In for Pricing
View Details
Recombinant Claudin-1 Antibody
RC-16870-03 1 mL

Recombinant Claudin-1 Antibody

Sign In for Pricing
View Details
DEGS1 Rabbit Polyclonal Antibody
AP05308PU-N 100 µg

DEGS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Serpina3j Mouse Gene Knockout Kit (CRISPR)
KN515567 1 Kit

Serpina3j Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
c-Jun (JUN) Rabbit Polyclonal Antibody
AP06056PU-N 100 µg

c-Jun (JUN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details