Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WISP2 Peptide - C-terminal region

WISP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCN5, CT58, CTGF-L

UniProt

O76076

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WISP2 Rabbit Polyclonal Antibody (orb585884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003872

Preservative

Lyophilized powder

AA Sequence

WGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish calcium/calmodulin-dependent protein kinase-II (CAMK 2) ELISA Kit
CK-bio-26590-01 48 Tests

Fish calcium/calmodulin-dependent protein kinase-II (CAMK 2) ELISA Kit

Sign In for Pricing
View Details
Fish calcium/calmodulin-dependent protein kinase-II (CAMK 2) ELISA Kit
CK-bio-26590-02 96 Tests

Fish calcium/calmodulin-dependent protein kinase-II (CAMK 2) ELISA Kit

Sign In for Pricing
View Details
HOXC4 Mouse Monoclonal Antibody [Clone ID: OTI2A5]
TA809725S 30 µL

HOXC4 Mouse Monoclonal Antibody [Clone ID: OTI2A5]

Sign In for Pricing
View Details
Rcbtb1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6497803 1.0 µg DNA

Rcbtb1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
FPGT, Recombinant, Human, aa1-594, His-Tag (Fucose-1-phosphate Guanylyltransferase)
373363-01 20 µg

FPGT, Recombinant, Human, aa1-594, His-Tag (Fucose-1-phosphate Guanylyltransferase)

Sign In for Pricing
View Details
FPGT, Recombinant, Human, aa1-594, His-Tag (Fucose-1-phosphate Guanylyltransferase)
373363-02 100 µg

FPGT, Recombinant, Human, aa1-594, His-Tag (Fucose-1-phosphate Guanylyltransferase)

Sign In for Pricing
View Details