Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WISP2 Peptide - C-terminal region

WISP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCN5, CT58, CTGF-L

UniProt

O76076

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WISP2 Rabbit Polyclonal Antibody (orb585884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003872

Preservative

Lyophilized powder

AA Sequence

WGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSF3R (Center) Rabbit pAb
E2620172 100 µL

CSF3R (Center) Rabbit pAb

Sign In for Pricing
View Details
CDC42EP5 Protein Vector (Rat) (pPB-N-His)
PV258871 500 ng

CDC42EP5 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
DUSP23 CRISPR Knock Out 293T Cell Line (Human)
18683141 1x 10^6 Cells / 1.0 mL

DUSP23 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Anti-PKC-pan Antibody
MBS9233573-01 0.1 mL

Anti-PKC-pan Antibody

Sign In for Pricing
View Details
Anti-PKC-pan Antibody
MBS9233573-02 5x 0.1 mL

Anti-PKC-pan Antibody

Sign In for Pricing
View Details
KRTAP5-2 CRISPRa sgRNA lentivector (set of three targets)(Human)
26199121 3x 1.0µg DNA

KRTAP5-2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details