Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB3C Peptide - C-terminal region

RAB3C Peptide - C-terminal region

Product Specifications

UniProt

Q96E17

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB3C Rabbit Polyclonal Antibody (orb331275) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612462

Preservative

Lyophilized powder

AA Sequence

GNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat F box/WD repeat containing protein 2 (FBXW2) ELISA Kit
GTR10327973 96 Well

Goat F box/WD repeat containing protein 2 (FBXW2) ELISA Kit

Sign In for Pricing
View Details
IRAK2 (Interleukin-1 Receptor-associated Kinase 2, IRAK-2, MGC150550) (MaxLight 650)
MBS6228306-01 0.1 mL

IRAK2 (Interleukin-1 Receptor-associated Kinase 2, IRAK-2, MGC150550) (MaxLight 650)

Sign In for Pricing
View Details
IRAK2 (Interleukin-1 Receptor-associated Kinase 2, IRAK-2, MGC150550) (MaxLight 650)
MBS6228306-02 5x 0.1 mL

IRAK2 (Interleukin-1 Receptor-associated Kinase 2, IRAK-2, MGC150550) (MaxLight 650)

Sign In for Pricing
View Details
Mouse bFGF/FGF2 (Basic Fibroblast Growth Factor) CLIA Kit
MBS2531466-01 96 Tests

Mouse bFGF/FGF2 (Basic Fibroblast Growth Factor) CLIA Kit

Sign In for Pricing
View Details
Mouse bFGF/FGF2 (Basic Fibroblast Growth Factor) CLIA Kit
MBS2531466-02 5x 96 Tests

Mouse bFGF/FGF2 (Basic Fibroblast Growth Factor) CLIA Kit

Sign In for Pricing
View Details
HSP60 Antibody [LK2]
33-142 100 µg

HSP60 Antibody [LK2]

Sign In for Pricing
View Details