FKBP10 Peptide - C-terminal region
FKBP10 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FKBP65, FLJ20683, FLJ22041, FLJ23833, PPIASE, hFKBP65, OI6, OI11
UniProt
Q96AY3
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FKBP10 Rabbit Polyclonal Antibody (orb586147) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_068758
Preservative
Lyophilized powder
AA Sequence
GKGRLMPGQDPEKTIGDMFQNQDRNQDGKITVDELKLKSDEDEERVHEEL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880029-500 1x 500 µL
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041952-500 1x 500 µL
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1952), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940470-500 1x 500 µL
CD45 / LCA (2B11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details