FUZ Peptide - C-terminal region
FUZ Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ22688, FY
UniProt
Q9BT04
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FUZ Rabbit Polyclonal Antibody (orb586150) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001165408
Preservative
Lyophilized powder
AA Sequence
RCLFTVEPLGDKEPSPEQRRRLLRNFYTLVTSTHFPPEPGPPEKTEDEVY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470158-100 1x 100 µL
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680270-100 1x 100 µL
Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941023-100 1x 100 µL
Bcl-2 (BCL2/782 + BCL2/796), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942966-500 1x 500 µL
C1QB / Complement C1q B-Chain (C1QB/2966), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details