NMUR1 Peptide - C-terminal region
NMUR1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
(FM-3), FM-3, FM3, GPC-R, GPR66, NMU1R
UniProt
Q9HB89
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NMUR1 Rabbit Polyclonal Antibody (orb586154) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
AAC02680
Preservative
Lyophilized powder
AA Sequence
CHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQQETDPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HA725129B 100 µL
Mouse/Rat Prealbumin Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details ![NeuN Recombinant Mouse Monoclonal Antibody [PD01-45]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81b3d/imageurl/ha601111.webp)
HA601111 100 µL
NeuN Recombinant Mouse Monoclonal Antibody [PD01-45]
Sign In for Pricing
View Details 
TRC-F307550-5ML 5 mL
Ferroin Sulfate (0.025M aq solution) (Technical Grade)
Sign In for Pricing
View Details 