NMUR1 Peptide - C-terminal region
NMUR1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
(FM-3), FM-3, FM3, GPC-R, GPR66, NMU1R
UniProt
Q9HB89
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NMUR1 Rabbit Polyclonal Antibody (orb586154) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
AAC02680
Preservative
Lyophilized powder
AA Sequence
CHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQQETDPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY419106 100 µg
Proteasome subunit beta type 4 (PSMB4) (NM_002796) Human Over-expression Lysate
Sign In for Pricing
View Details 
HA750436 100 µL
Angiopoietin 2 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
#92236 1 Kit
Mix-n-StainTM CF®594 Antibody Labeling Kit, 1x (50-100ug) labeling
Sign In for Pricing
View Details 
