Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPT Peptide - C-terminal region

TFPT Peptide - C-terminal region

Product Specifications

Product Name Alternative

FB1, INO80F, amida

UniProt

P0C1Z6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFPT Rabbit Polyclonal Antibody (orb586159) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037474

Preservative

Lyophilized powder

AA Sequence

DDYRASQFTIVLEDEGSQGTDAPTPGNAENEPPEKETLSPPRRTPAPPEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), Biotin conjugate, 0.1mg/mL
BNCB0225-500 1x 500 µL

Major Vault Protein (MVP) (1032), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2715), CF488A conjugate, 0.1mg/mL
BNC882715-100 1x 100 µL

PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2715), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Osutidine Hydrochloride Salt
TRC-O703910-50MG 50 mg

Osutidine Hydrochloride Salt

Sign In for Pricing
View Details
Ethyl 4-Hydrazinylbenzoate
TRC-E938768-250MG 250 mg

Ethyl 4-Hydrazinylbenzoate

Sign In for Pricing
View Details
PTEN Rabbit Polyclonal Antibody
AP02597PU-S 50 µL

PTEN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon
CD563789 5 µg

Tissue Genomic DNA, Colon

Sign In for Pricing
View Details