Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BIN3 Peptide - N-terminal region

BIN3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC14978

UniProt

Q9NQY0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BIN3 Rabbit Polyclonal Antibody (orb586162) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061158

Preservative

Lyophilized powder

AA Sequence

IGQPKKQIVPKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NOX4 Monoclonal Antibody (Clone: ABM5F63)
MBS669655-01 0.1 mg

Anti-NOX4 Monoclonal Antibody (Clone: ABM5F63)

Sign In for Pricing
View Details
Anti-NOX4 Monoclonal Antibody (Clone: ABM5F63)
MBS669655-02 5x 0.1 mg

Anti-NOX4 Monoclonal Antibody (Clone: ABM5F63)

Sign In for Pricing
View Details
Zebrafish HNRNPA1a/b Rabbit Polyclonal Antibody (HRP)
orb2804996 100 µg

Zebrafish HNRNPA1a/b Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
MRPS11 siRNA (Human)
MBS827760-01 15 nmol

MRPS11 siRNA (Human)

Sign In for Pricing
View Details
MRPS11 siRNA (Human)
MBS827760-02 30 nmol

MRPS11 siRNA (Human)

Sign In for Pricing
View Details
MRPS11 siRNA (Human)
MBS827760-03 5x 30 nmol

MRPS11 siRNA (Human)

Sign In for Pricing
View Details