Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BIN3 Peptide - N-terminal region

BIN3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC14978

UniProt

Q9NQY0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BIN3 Rabbit Polyclonal Antibody (orb586162) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061158

Preservative

Lyophilized powder

AA Sequence

IGQPKKQIVPKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMS1 Antibody
orb848755 2 mg

PMS1 Antibody

Sign In for Pricing
View Details
UGT3A2 Protein Vector (Mouse) (pPM-C-HA)
PV244064 500 ng

UGT3A2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Glycodeoxycholate Sodium
orb1301952-01 100 mg

Glycodeoxycholate Sodium

Sign In for Pricing
View Details
Glycodeoxycholate Sodium
orb1301952-02 1 ml x 10 mM (in DMSO)

Glycodeoxycholate Sodium

Sign In for Pricing
View Details
FLNC Polyclonal Antibody
E-AB-19875-01 20 µL

FLNC Polyclonal Antibody

Sign In for Pricing
View Details
FLNC Polyclonal Antibody
E-AB-19875-02 60 µL

FLNC Polyclonal Antibody

Sign In for Pricing
View Details