Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCL1B Peptide - N-terminal region

TCL1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

TML1

UniProt

O95988

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCL1B Rabbit Polyclonal Antibody (orb326525) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004909

Preservative

Lyophilized powder

AA Sequence

NPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1191 (NM_001079685) Human Over-expression Lysate
LY421536 100 µg

KIAA1191 (NM_001079685) Human Over-expression Lysate

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (rMMP3/1730), Biotin conjugate, 0.1mg/mL
BNCB2306-100 1x 100 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (rMMP3/1730), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pentachlorophenol
TRC-P238100-5G 5 g

Pentachlorophenol

Sign In for Pricing
View Details
RealStar®HEV RT-PCR Kit 2.0
272013 96 Tests

RealStar®HEV RT-PCR Kit 2.0

Sign In for Pricing
View Details
Human PARK7 Recombinant Mouse monoclonal Antibody
HA620002B 100 µL

Human PARK7 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SLAMF7 Antibody
RN-046-01 50 μL

Recombinant SLAMF7 Antibody

Sign In for Pricing
View Details