Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCL1B Peptide - N-terminal region

TCL1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

TML1

UniProt

O95988

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCL1B Rabbit Polyclonal Antibody (orb326525) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004909

Preservative

Lyophilized powder

AA Sequence

NPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 (KRT18/835), CF647 conjugate, 0.1mg/mL
BNC470835-100 1x 100 µL

Cytokeratin 18 (KRT18/835), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ERp72 (PDIA4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F1]
TA503883BM 100 µL

ERp72 (PDIA4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F1]

Sign In for Pricing
View Details
Human Breast Cancer Associated Fibroblas
CAF06 1000000 Cells

Human Breast Cancer Associated Fibroblas

Sign In for Pricing
View Details
C10orf97 (FAM188A) (NM_024948) Human Recombinant Protein
TP309783M 100 µg

C10orf97 (FAM188A) (NM_024948) Human Recombinant Protein

Sign In for Pricing
View Details
Human PRAM1 activation kit by CRISPRa
GA113374 1 Kit

Human PRAM1 activation kit by CRISPRa

Sign In for Pricing
View Details
EIF2AK1 Human Gene Knockout Kit (CRISPR)
KN200065BN 1 Kit

EIF2AK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details