Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPRIN1 Peptide - C-terminal region

CAPRIN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPIAP1, GPIP137, M11S1, caprin-1, p137GPI

UniProt

Q14444

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPRIN1 Rabbit Polyclonal Antibody (orb586189) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005889

Preservative

Lyophilized powder

AA Sequence

HQVTGNHQQPPQQNTGFPRSNQPYYNSRGVSRGGSRGARGLMNGYRGPAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAPSS2 (NM_001015880) Human Over-expression Lysate
LY423129 100 µg

PAPSS2 (NM_001015880) Human Over-expression Lysate

Sign In for Pricing
View Details
Vitamin D Receptor (VDR) Human Gene Knockout Kit (CRISPR)
KN209262BN 1 Kit

Vitamin D Receptor (VDR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DODC (DiOC2 (5) ) (high purity)
#40040 1x 50 mg

DODC (DiOC2 (5) ) (high purity)

Sign In for Pricing
View Details
Human RNF185 activation kit by CRISPRa
GA114116 1 Kit

Human RNF185 activation kit by CRISPRa

Sign In for Pricing
View Details
DACT3 Mouse Monoclonal Antibody [Clone ID: 2A5]
AM09054PU-S 50 µL

DACT3 Mouse Monoclonal Antibody [Clone ID: 2A5]

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/2754), CF568 conjugate, 0.1mg/mL
BNC682754-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/2754), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details