Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPRIN1 Peptide - C-terminal region

CAPRIN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPIAP1, GPIP137, M11S1, caprin-1, p137GPI

UniProt

Q14444

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPRIN1 Rabbit Polyclonal Antibody (orb586189) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005889

Preservative

Lyophilized powder

AA Sequence

HQVTGNHQQPPQQNTGFPRSNQPYYNSRGVSRGGSRGARGLMNGYRGPAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACC1 Mouse Monoclonal Antibody [Clone ID: OTI1H2]
CF805373 100 µg

TACC1 Mouse Monoclonal Antibody [Clone ID: OTI1H2]

Sign In for Pricing
View Details
bis(4-Allyloxyphenyl)sulfone
TRC-A614508-1G 1 g

bis(4-Allyloxyphenyl)sulfone

Sign In for Pricing
View Details
CXXC4 (C-term) Goat Polyclonal Antibody
AP32075PU-N 100 µg

CXXC4 (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
SRPK2 Antibody
KC-3558-01 50 μL

SRPK2 Antibody

Sign In for Pricing
View Details
SRPK2 Antibody
KC-3558-02 100 µL

SRPK2 Antibody

Sign In for Pricing
View Details
SRPK2 Antibody
KC-3558-03 1 mL

SRPK2 Antibody

Sign In for Pricing
View Details