Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPRIN1 Peptide - C-terminal region

CAPRIN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPIAP1, GPIP137, M11S1, caprin-1, p137GPI

UniProt

Q14444

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPRIN1 Rabbit Polyclonal Antibody (orb586190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005889

Preservative

Lyophilized powder

AA Sequence

FSAPRDYSGYQRDGYQQNFKRGSGQSGPRGAPRGRGGPPRPNRGMPQMNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human mastadenovirus B (HAdV-B) encapsidation protein IVa2 Recombinant (His Tag)
PKSV030212 100 µg

Recombinant Human mastadenovirus B (HAdV-B) encapsidation protein IVa2 Recombinant (His Tag)

Sign In for Pricing
View Details
Cortisol ELISA Kit
K003-H1 1 Plate

Cortisol ELISA Kit

Sign In for Pricing
View Details
Tissue Total RNA, Myometrium
CR560270 5 µg

Tissue Total RNA, Myometrium

Sign In for Pricing
View Details
Meta-Phosphoric Acid
MPA-2G 100 Tests

Meta-Phosphoric Acid

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (CLIP/2859R), CF568 conjugate, 0.1mg/mL
BNC682859-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (CLIP/2859R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CRKL Rabbit Polyclonal Antibody
TA392885 100 µL

CRKL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details