Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPRIN1 Peptide - C-terminal region

CAPRIN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPIAP1, GPIP137, M11S1, caprin-1, p137GPI

UniProt

Q14444

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPRIN1 Rabbit Polyclonal Antibody (orb586190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005889

Preservative

Lyophilized powder

AA Sequence

FSAPRDYSGYQRDGYQQNFKRGSGQSGPRGAPRGRGGPPRPNRGMPQMNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CT47A3 activation kit by CRISPRa
GA118906 1 Kit

Human CT47A3 activation kit by CRISPRa

Sign In for Pricing
View Details
N-Acetyl-S-benzyl-d5-L-cysteine
TRC-A168429-25MG 25 mg

N-Acetyl-S-benzyl-d5-L-cysteine

Sign In for Pricing
View Details
Occludin (Marker of Early Blood Brain Barrier Damage) (OCLN/2181), CF640R conjugate, 0.1mg/mL
BNC402181-100 1x 100 µL

Occludin (Marker of Early Blood Brain Barrier Damage) (OCLN/2181), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dystrophia myotonica protein kinase (DMPK) (NM_001081562) Human Over-expression Lysate
LY421165 100 µg

Dystrophia myotonica protein kinase (DMPK) (NM_001081562) Human Over-expression Lysate

Sign In for Pricing
View Details
Fmoc-Glu (t-Bu) Wang Resin
H0370751312.1G 1 g

Fmoc-Glu (t-Bu) Wang Resin

Sign In for Pricing
View Details
RNA/Protein Purification Plus Kit
48200 50 Preparations

RNA/Protein Purification Plus Kit

Sign In for Pricing
View Details