Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX7A1 Peptide - N-terminal region

COX7A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

COX7A, COX7AH, COX7AM

UniProt

P24310

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COX7A1 Rabbit Polyclonal Antibody (orb586193) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001855

Preservative

Lyophilized powder

AA Sequence

SQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Menthyl Lactate
TRC-M220795-5G 5 g

L-Menthyl Lactate

Sign In for Pricing
View Details
SCARB1 Human Knockdown Lysate
LY300425 100 µg

SCARB1 Human Knockdown Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS625698 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Recombinant PFKP Antibody
RC-4598-01 50 μL

Recombinant PFKP Antibody

Sign In for Pricing
View Details
Recombinant PFKP Antibody
RC-4598-02 100 µL

Recombinant PFKP Antibody

Sign In for Pricing
View Details
Recombinant PFKP Antibody
RC-4598-03 1 mL

Recombinant PFKP Antibody

Sign In for Pricing
View Details