Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX7A1 Peptide - N-terminal region

COX7A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

COX7A, COX7AH, COX7AM

UniProt

P24310

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COX7A1 Rabbit Polyclonal Antibody (orb586193) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001855

Preservative

Lyophilized powder

AA Sequence

SQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-[(1,3-Dihydro-1,3-dioxo-2H-isoindol-2-yl)acetyl]-butanedioic-2-13C Acid Diethyl Ester
TRC-D449107-2.5MG 2.5 mg

2-[(1,3-Dihydro-1,3-dioxo-2H-isoindol-2-yl)acetyl]-butanedioic-2-13C Acid Diethyl Ester

Sign In for Pricing
View Details
RPS19 Recombinant Rabbit Monoclonal Antibody [JU33-43]
ET7106-94 100 µL

RPS19 Recombinant Rabbit Monoclonal Antibody [JU33-43]

Sign In for Pricing
View Details
Mouse Ap3b1 activation kit by CRISPRa
GA200213 1 Kit

Mouse Ap3b1 activation kit by CRISPRa

Sign In for Pricing
View Details
ProDynorphin (PDYN) Rabbit Polyclonal Antibody
TA364063 50 µL

ProDynorphin (PDYN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
rac-Hesperetin 7-O-Sulfate Sodium Salt
TRC-H289546-5MG 5 mg

rac-Hesperetin 7-O-Sulfate Sodium Salt

Sign In for Pricing
View Details
VLDL-Receptor (Very Low Density Lipoprotein Receptor) (VLDLR/2896R), CF405S conjugate, 0.1mg/mL
BNC042896-100 1x 100 µL

VLDL-Receptor (Very Low Density Lipoprotein Receptor) (VLDLR/2896R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details