Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX7C Peptide - N-terminal region

COX7C Peptide - N-terminal region

Product Specifications

UniProt

P15954

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COX7C Rabbit Polyclonal Antibody (orb586213) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001858

Preservative

Lyophilized powder

AA Sequence

SVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Caenorhabditis Elegans C08F11.12 Protein (aa 21-117)
VAng-Ly3128-50gEcoli 50 µg (E. coli)

Recombinant Caenorhabditis Elegans C08F11.12 Protein (aa 21-117)

Sign In for Pricing
View Details
Recombinant Human BTN1A1 Protein, C-His (Active)
AHG51601 100 μg

Recombinant Human BTN1A1 Protein, C-His (Active)

Sign In for Pricing
View Details
Recombinant Anti-IFNGR1 Rabbit mAb
CMA6307-01 30 µL

Recombinant Anti-IFNGR1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-IFNGR1 Rabbit mAb
CMA6307-02 50 μL

Recombinant Anti-IFNGR1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-IFNGR1 Rabbit mAb
CMA6307-03 100 µL

Recombinant Anti-IFNGR1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-IFNGR1 Rabbit mAb
CMA6307-04 200 µL

Recombinant Anti-IFNGR1 Rabbit mAb

Sign In for Pricing
View Details