Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LANCL1 Peptide - N-terminal region

LANCL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GPR69A, p40

UniProt

O43813

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LANCL1 Rabbit Polyclonal Antibody (orb586224) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006046

Preservative

Lyophilized powder

AA Sequence

QRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Neurotensin Receptor 2 (NTSR2) ELISA Kit
DLR-NTSR2-Hu-48T 48 Tests

Human Neurotensin Receptor 2 (NTSR2) ELISA Kit

Sign In for Pricing
View Details
Wnt-7a/b (H-8) Alexa Fluor® 488
sc-365459 AF488 200 µg/mL

Wnt-7a/b (H-8) Alexa Fluor® 488

Sign In for Pricing
View Details
RSPH14 Polyclonal Antibody
A72193-100 100 µL

RSPH14 Polyclonal Antibody

Sign In for Pricing
View Details
Prometon [CAS:1610-18-0] 100 ug/ml in Acetonitrile
P849120 1 mL

Prometon [CAS:1610-18-0] 100 ug/ml in Acetonitrile

Sign In for Pricing
View Details
Polyclonal Antibody to NF-KB-p65 (Phospho-Thr505)
35-1159-50 50 μL

Polyclonal Antibody to NF-KB-p65 (Phospho-Thr505)

Sign In for Pricing
View Details
NDUFS8 discontinued
325469 100 µL

NDUFS8 discontinued

Sign In for Pricing
View Details