Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LANCL1 Peptide - N-terminal region

LANCL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GPR69A, p40

UniProt

O43813

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LANCL1 Rabbit Polyclonal Antibody (orb586224) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006046

Preservative

Lyophilized powder

AA Sequence

QRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-Mouse IgM Cross-Adsorbed Antibody DyLight 800 Conjugated
MBS3907206-01 0.5 mg

Goat anti-Mouse IgM Cross-Adsorbed Antibody DyLight 800 Conjugated

Sign In for Pricing
View Details
Goat anti-Mouse IgM Cross-Adsorbed Antibody DyLight 800 Conjugated
MBS3907206-02 5x 0.5 mg

Goat anti-Mouse IgM Cross-Adsorbed Antibody DyLight 800 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal OTOP1 Antibody [Allophycocyanin]
NBP3-06362APC 0.1 mL

Rabbit Polyclonal OTOP1 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
SMARCA4 Recombinant Antibody, RBITC Conjugated
bsm-61308R-RBITC-TR 20 µL

SMARCA4 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Bovine Lysophosphatidylcholine Acyltransferase 4 ELISA kit
GTR10429089 96 Well

Bovine Lysophosphatidylcholine Acyltransferase 4 ELISA kit

Sign In for Pricing
View Details
Rabbit Monoclonal Annexin A4 Antibody (SAIC-14C-10F12) [mFluor Violet 610 SE]
NBP3-20093MFV610 0.1 mL

Rabbit Monoclonal Annexin A4 Antibody (SAIC-14C-10F12) [mFluor Violet 610 SE]

Sign In for Pricing
View Details