ASGR1 Peptide - middle region
ASGR1 Peptide - middle region
Product Specifications
Product Name Alternative
ASGPR, CLEC4H1, Hs.12056, HL-1, ASGPR1
UniProt
P07306
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ASGR1 Rabbit Polyclonal Antibody (orb574828) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001662
Preservative
Lyophilized powder
AA Sequence
RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15354855 1 Vial
Lentiviral human H3C3 sgRNA gene knockout kit - Lentiviral human H3C3 sgRNA gene knockout kit (100)
Sign In for Pricing
View Details 
MBS7034836-01 0.02 mg
Recombinant Shewanella baltica Membrane protein insertase YidC (yidC)
Sign In for Pricing
View Details MBS7034836-02 0.1 mg
Recombinant Shewanella baltica Membrane protein insertase YidC (yidC)
Sign In for Pricing
View Details MBS7034836-03 5x 0.1 mg
Recombinant Shewanella baltica Membrane protein insertase YidC (yidC)
Sign In for Pricing
View Details