Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naa60 Peptide - N-terminal region

Naa60 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC124897, RGD1308915

UniProt

Q3MHC1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Naa60 Rabbit Polyclonal Antibody (orb325402) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001014248

Preservative

Lyophilized powder

AA Sequence

IVGMIVAEIKNRTKIHKEDGDILASSFSVDTQVAYILSLGVVKEFRKHGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PSPC1 activation kit by CRISPRa
GA110658 1 Kit

Human PSPC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 15 Recombinant Rabbit monoclonal Antibody
HA750182 100 µL

Cytokeratin 15 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
HCAR2 Human Gene Knockout Kit (CRISPR)
KN206527BN 1 Kit

HCAR2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-Oxo-4-aza-5alpha-androstan-17beta-carboxylic Acid
TRC-O869500-1G 1 g

3-Oxo-4-aza-5alpha-androstan-17beta-carboxylic Acid

Sign In for Pricing
View Details
CD35 / CR1 (E11), 0.2mg/mL
BNUB0040-500 1x 500 µL

CD35 / CR1 (E11), 0.2mg/mL

Sign In for Pricing
View Details
Ethidium bromide (EB), 10mg/mL in H2O
#40042 1x 10 mL

Ethidium bromide (EB), 10mg/mL in H2O

Sign In for Pricing
View Details