Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naa60 Peptide - N-terminal region

Naa60 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC124897, RGD1308915

UniProt

Q3MHC1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Naa60 Rabbit Polyclonal Antibody (orb325402) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001014248

Preservative

Lyophilized powder

AA Sequence

IVGMIVAEIKNRTKIHKEDGDILASSFSVDTQVAYILSLGVVKEFRKHGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARK3 Mouse Monoclonal Antibody [Clone ID: OTI2D9]
CF805790 100 µg

MARK3 Mouse Monoclonal Antibody [Clone ID: OTI2D9]

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS700929 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
PROX1 Rabbit Monoclonal Antibody [Clone ID: R02-8H5]
TA422051 100 µL

PROX1 Rabbit Monoclonal Antibody [Clone ID: R02-8H5]

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS629054 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Cap2 Mouse Gene Knockout Kit (CRISPR)
KN502500 1 Kit

Cap2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Spleen
CS800737 5x 5 µm

Tissue FFPE Sections, Spleen

Sign In for Pricing
View Details