Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR137 Peptide - N-terminal region

GPR137 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C11orf4, GPR137A, TM7SF1L1

UniProt

Q96N19

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR137 Rabbit Polyclonal Antibody (orb580747) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001164351

Preservative

Lyophilized powder

AA Sequence

ESNLSGLVPAAGLVPALPPAVTLGLTAAYTTLYALLFFSVYAQLWLVLLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF12 Human shRNA Lentiviral Particle (Locus ID 7559)
TL300296V 500 µL Each

ZNF12 Human shRNA Lentiviral Particle (Locus ID 7559)

Sign In for Pricing
View Details
NR4A1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0002905 3x 1.0 µg

NR4A1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ADPβS
orb64175 25 mg

ADPβS

Sign In for Pricing
View Details
MICF sgRNA CRISPR Lentivector (Human) (Target 2)
K1302203 1.0 µg DNA

MICF sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
NBPF20 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV736040 1.0 µg DNA

NBPF20 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Human Arylamine N-acetyltransferase 2, NAT2 ELISA KIT
E7669Hu-01 48 Well

Human Arylamine N-acetyltransferase 2, NAT2 ELISA KIT

Sign In for Pricing
View Details