Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR137 Peptide - N-terminal region

GPR137 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C11orf4, GPR137A, TM7SF1L1

UniProt

Q96N19

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR137 Rabbit Polyclonal Antibody (orb580747) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001164351

Preservative

Lyophilized powder

AA Sequence

ESNLSGLVPAAGLVPALPPAVTLGLTAAYTTLYALLFFSVYAQLWLVLLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (2-Acetoxy-ethyl) phenyl Acetate
001164 500 mg

4- (2-Acetoxy-ethyl) phenyl Acetate

Sign In for Pricing
View Details
GPER 3'UTR Luciferase Stable Cell Line
TU009123 1.0 mL

GPER 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
3'-O-Azidomethyl-dTTP
orb533267 1 mg

3'-O-Azidomethyl-dTTP

Sign In for Pricing
View Details
BTG2 Mouse Monoclonal Antibody [Clone 2G5]
E45M18163V-2 50 µL

BTG2 Mouse Monoclonal Antibody [Clone 2G5]

Sign In for Pricing
View Details
Recombinant Anaeromyxobacter sp. Glycerol-3-phosphate acyltransferase (plsY)
MBS1153838 Inquire

Recombinant Anaeromyxobacter sp. Glycerol-3-phosphate acyltransferase (plsY)

Sign In for Pricing
View Details
Anti-Transferrin Receptor/TFRC Antibody (2H693)
TMAY-03441 100 µL

Anti-Transferrin Receptor/TFRC Antibody (2H693)

Sign In for Pricing
View Details