LOC100361560 Peptide - N-terminal region
LOC100361560 Peptide - N-terminal region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
XP_002728408
Preservative
Lyophilized powder
AA Sequence
MGEIEQKPTPASRLGAPENSGISTLERGQKPPPTPSGKLMTVKIQMLDDT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402034-100 1x 100 µL
CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880795-500 1x 500 µL
CD56 / NCAM (NCAM1/795), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401888-500 1x 500 µL
CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682055-100 1x 100 µL
Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details