Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Capzb Peptide - C-terminal region

Capzb Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC95097

UniProt

Q5XI32

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Capzb Rabbit Polyclonal Antibody (orb330976) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005903

Preservative

Lyophilized powder

AA Sequence

VEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LZP (h) -PR
sc-90538-PR 10 µM - 20 µL

LZP (h) -PR

Sign In for Pricing
View Details
PACSIN2 (NM_001184971) Human Tagged ORF Clone Lentiviral Particle
RC230094L3V 200 µL

PACSIN2 (NM_001184971) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PD-L1 (AB5381) Mouse mAb
V0592-01 20 µL

PD-L1 (AB5381) Mouse mAb

Sign In for Pricing
View Details
PD-L1 (AB5381) Mouse mAb
V0592-02 50 μL

PD-L1 (AB5381) Mouse mAb

Sign In for Pricing
View Details
PD-L1 (AB5381) Mouse mAb
V0592-03 100 µL

PD-L1 (AB5381) Mouse mAb

Sign In for Pricing
View Details
PD-L1 (AB5381) Mouse mAb
V0592-04 200 µL

PD-L1 (AB5381) Mouse mAb

Sign In for Pricing
View Details