Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Capzb Peptide - C-terminal region

Capzb Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC95097

UniProt

Q5XI32

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Capzb Rabbit Polyclonal Antibody (orb330976) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005903

Preservative

Lyophilized powder

AA Sequence

VEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse mHGF Protein
orb752943-01 2 µg

Mouse mHGF Protein

Sign In for Pricing
View Details
Mouse mHGF Protein
orb752943-02 10 µg

Mouse mHGF Protein

Sign In for Pricing
View Details
Mouse mHGF Protein
orb752943-03 1 mg

Mouse mHGF Protein

Sign In for Pricing
View Details
TMC8 cDNA Clone
MBS1275728-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

TMC8 cDNA Clone

Sign In for Pricing
View Details
TMC8 cDNA Clone
MBS1275728-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

TMC8 cDNA Clone

Sign In for Pricing
View Details
Rabbit anti-TBL3 Antibody, Affinity Purified
MBS3904943-01 0.01 mg

Rabbit anti-TBL3 Antibody, Affinity Purified

Sign In for Pricing
View Details