Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALN1 Peptide - N-terminal region

CALN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CABP8

UniProt

Q9BXU9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CALN1 Rabbit Polyclonal Antibody (orb326426) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113656

Preservative

Lyophilized powder

AA Sequence

PGEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKMPFHHVTAGLLYKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOC6B Antibody - middle region
ARP96803_P050-25UL 25 µL

EXOC6B Antibody - middle region

Sign In for Pricing
View Details
FOXP1 mouse monoclonal antibody
E43B4375 100 µL

FOXP1 mouse monoclonal antibody

Sign In for Pricing
View Details
TRAIL/TNFSF10 Trimer, Human (HEK293, His-Flag)
HY-P78528-01 20 µg

TRAIL/TNFSF10 Trimer, Human (HEK293, His-Flag)

Sign In for Pricing
View Details
TRAIL/TNFSF10 Trimer, Human (HEK293, His-Flag)
HY-P78528-02 50 µg

TRAIL/TNFSF10 Trimer, Human (HEK293, His-Flag)

Sign In for Pricing
View Details
TRAIL/TNFSF10 Trimer, Human (HEK293, His-Flag)
HY-P78528-03 100 µg

TRAIL/TNFSF10 Trimer, Human (HEK293, His-Flag)

Sign In for Pricing
View Details
mmu-miR-330-5p miRNA Mimic
MBS8301064-01 5 nmol

mmu-miR-330-5p miRNA Mimic

Sign In for Pricing
View Details