Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALN1 Peptide - N-terminal region

CALN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CABP8

UniProt

Q9BXU9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CALN1 Rabbit Polyclonal Antibody (orb326426) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113656

Preservative

Lyophilized powder

AA Sequence

PGEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKMPFHHVTAGLLYKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNK2 Antibody, HRP conjugated
A71994-100UG 100 µg

WNK2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Alphitonin
MBS5802622 Inquire

Alphitonin

Sign In for Pricing
View Details
SSBP2 Human siRNA Oligo Duplex (Locus ID 23635)
SR308417 1 Kit

SSBP2 Human siRNA Oligo Duplex (Locus ID 23635)

Sign In for Pricing
View Details
Histone H2B
318975-01 50 µg

Histone H2B

Sign In for Pricing
View Details
Histone H2B
318975-02 100 µg

Histone H2B

Sign In for Pricing
View Details
SAP62 Polyclonal Antibody, FITC Conjugated
bs-6997R-FITC 100 µL

SAP62 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details