Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRISP3 Peptide - N-terminal region

CRISP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Aeg2, CRISP-3, CRS3, MGC126588, SGP28, dJ442L6.3

UniProt

P54108

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRISP3 Rabbit Polyclonal Antibody (orb585930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006052

Preservative

Lyophilized powder

AA Sequence

PARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL-12B Antibody (Detection)
CAP1076-D-01 100 µg

Anti-IL-12B Antibody (Detection)

Sign In for Pricing
View Details
Anti-IL-12B Antibody (Detection)
CAP1076-D-02 1 mg

Anti-IL-12B Antibody (Detection)

Sign In for Pricing
View Details
NUP88 siRNA (Human)
CRH3277-01 15 nmol

NUP88 siRNA (Human)

Sign In for Pricing
View Details
NUP88 siRNA (Human)
CRH3277-02 30 nmol

NUP88 siRNA (Human)

Sign In for Pricing
View Details
C11orf10 (TMEM258) (NM_014206) Human Tagged ORF Clone
RG204821 10 µg

C11orf10 (TMEM258) (NM_014206) Human Tagged ORF Clone

Sign In for Pricing
View Details
6-Chloro-3-methoxy-2-methylpyridine
OR1007730-01 250 mg

6-Chloro-3-methoxy-2-methylpyridine

Sign In for Pricing
View Details