CRISP3 Peptide - N-terminal region
CRISP3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Aeg2, CRISP-3, CRS3, MGC126588, SGP28, dJ442L6.3
UniProt
P54108
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CRISP3 Rabbit Polyclonal Antibody (orb585930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006052
Preservative
Lyophilized powder
AA Sequence
PARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10380255 96 Well
Porcine voltage-gated sodium channel type V, SCN5A ELISA Kit
Sign In for Pricing
View Details MBS6453785-01 0.1 mL
XRCC5 (Ku80, X Ray Repair Complementing Defective Repair in Chinese Hamster Cells 5 (Double-strand-break Rejoining), Heterodimer of Ku80 Subunits, Ku-80, Ku 80) (PE)
Sign In for Pricing
View Details MBS6453785-02 5x 0.1 mL
XRCC5 (Ku80, X Ray Repair Complementing Defective Repair in Chinese Hamster Cells 5 (Double-strand-break Rejoining), Heterodimer of Ku80 Subunits, Ku-80, Ku 80) (PE)
Sign In for Pricing
View Details 
MBS6342002-01 0.1 mL
RHOT1, NT (RHOT1, ARHT1, Mitochondrial Rho GTPase 1, Rac-GTP-binding protein-like protein, Ras homolog gene family member T1) (MaxLight 650)
Sign In for Pricing
View Details MBS6342002-02 5x 0.1 mL
RHOT1, NT (RHOT1, ARHT1, Mitochondrial Rho GTPase 1, Rac-GTP-binding protein-like protein, Ras homolog gene family member T1) (MaxLight 650)
Sign In for Pricing
View Details