Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFI30 Peptide - middle region

IFI30 Peptide - middle region

Product Specifications

Product Name Alternative

GILT, IFI-30, IP30, MGC32056

UniProt

P13284

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFI30 Rabbit Polyclonal Antibody (orb585942) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006323

Preservative

Lyophilized powder

AA Sequence

YGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCME

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIRC2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0184207 1.0 µg DNA

BIRC2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PTGER3 Antibody
MBS853822-01 0.1 mg

PTGER3 Antibody

Sign In for Pricing
View Details
PTGER3 Antibody
MBS853822-02 0.1 mL (AF635)

PTGER3 Antibody

Sign In for Pricing
View Details
PTGER3 Antibody
MBS853822-03 0.1 mL (AF610)

PTGER3 Antibody

Sign In for Pricing
View Details
PTGER3 Antibody
MBS853822-04 0.1 mL (AF405S)

PTGER3 Antibody

Sign In for Pricing
View Details
PTGER3 Antibody
MBS853822-05 0.1 mL (AF405L)

PTGER3 Antibody

Sign In for Pricing
View Details