Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFI30 Peptide - middle region

IFI30 Peptide - middle region

Product Specifications

Product Name Alternative

GILT, IFI-30, IP30, MGC32056

UniProt

P13284

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFI30 Rabbit Polyclonal Antibody (orb585942) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006323

Preservative

Lyophilized powder

AA Sequence

YGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAZ1A Knockout Raji Polyclonal Cells
ARG21357 1 Million

BAZ1A Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
Donkey Brain Derived Neurotrophic Factor ELISA Kit
MBS067261 Inquire

Donkey Brain Derived Neurotrophic Factor ELISA Kit

Sign In for Pricing
View Details
CYBRD1 Protein Vector (Rat) (pPB-C-His)
PV262658 500 ng

CYBRD1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Anti-OLIG2 Antibody (SAb2316)
RHG57002 100 μg

Anti-OLIG2 Antibody (SAb2316)

Sign In for Pricing
View Details
O51V1 Rabbit Polyclonal Antibody
E28PN2723 100 µL

O51V1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CPEB1 Protein Vector (Mouse) (pPM-C-HA)
PV167640 500 ng

CPEB1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details