Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TP53I3 Peptide - C-terminal region

TP53I3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PIG3

UniProt

B4DMQ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TP53I3 Rabbit Polyclonal Antibody (orb585990) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EAX00765

Preservative

Lyophilized powder

AA Sequence

SKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Naalad2 (NM_028279) Mouse Recombinant Protein
E45M43176M5 20 µg

Naalad2 (NM_028279) Mouse Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human Thrombospondin-5/COMP Protein
RP00258-01 50 μg

Recombinant Human Thrombospondin-5/COMP Protein

Sign In for Pricing
View Details
Recombinant Human Thrombospondin-5/COMP Protein
RP00258-02 500 μg

Recombinant Human Thrombospondin-5/COMP Protein

Sign In for Pricing
View Details
Recombinant Human Thrombospondin-5/COMP Protein
RP00258-03 1000 μg

Recombinant Human Thrombospondin-5/COMP Protein

Sign In for Pricing
View Details
Anti-SMYD3 Antibody Picoband® Fluoro550 Conjugated
PB9893-Fluoro550 100 µg/Vial

Anti-SMYD3 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
PLVAP Rabbit Polyclonal Antibody (AP)
orb963499 100 µL

PLVAP Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details